PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020406.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 145aa    MW: 16157.2 Da    PI: 6.7774
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020406.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB157.22.7e-49499297
        NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                 +eqd +lPianv+rimk++lP +akisk+ak+t+qec++ef+sfvt+easdkc++e+rkt+ngdd++wal+ lGf++y+++   yl+kyre+e++k
  Pbr020406.1  4 QEQDGMLPIANVGRIMKQILPPRAKISKEAKQTMQECATEFLSFVTGEASDKCHKENRKTVNGDDICWALSALGFDNYAQAAMRYLHKYREAERDK 99
                 69********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-474119IPR009072Histone-fold
SuperFamilySSF471133.22E-376120IPR009072Histone-fold
PfamPF008081.7E-251073IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-163755No hitNo description
PRINTSPR006151.7E-165674No hitNo description
PRINTSPR006151.7E-167593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MVDQEQDGML PIANVGRIMK QILPPRAKIS KEAKQTMQEC ATEFLSFVTG EASDKCHKEN  60
RKTVNGDDIC WALSALGFDN YAQAAMRYLH KYREAERDKA AANNNQNTEN IASHGGLQVR  120
EQIQTSNLEF RALEKGDNSL ITKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-39494292Transcription factor HapC (Eurofung)
4g92_B2e-39494292Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376649.11e-106PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO040275e-56NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLV4SG546e-67V4SG54_9R
STRINGPOPTR_0013s02030.12e-66(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.13e-57nuclear factor Y, subunit B4